PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa16g046370.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 468aa    MW: 52846 Da    PI: 10.2419
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa16g046370.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B362.95e-20104192595
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     ++++++l+ + l+lp +f++++g++k+   +++l+d +g+sWe++++y+k+ +r++  +GW++F+++ g k+g +++F+l++ + ++++++
  Csa16g046370.1 104 FVTASNLEADTLYLPQDFTSSCGLPKNFC-KVVLTDGTGNSWELEMRYDKSCNRFYVNRGWRHFCDELGKKVGSVFTFELMK-KWGTPFLS 192
                     6789999999**************99875.9************************************************998.77777766 PP

2B337.15.4e-12213306396
                     EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE.....EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
              B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliy...rkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                     +  ++ d+lk++rl+lp   ++++g+++++   +tl  ++g +   +l     r++ gr  l+k W+eF+ an+L++g+ ++++ ++ +++++ +
  Csa16g046370.1 213 TLNLSYDSLKNCRLYLPSAIMRTYGLDETR--LVTLLAKDGTRTIANLVRetsRRNFGRLSLGKAWREFALANNLEVGENFTLECIW-ENATPIL 304
                     55667799*******************776..688888888766666644344777777*************************999.6776777 PP

                     EE CS
              B3  95 kv 96 
                     ++
  Csa16g046370.1 305 RL 306
                     66 PP

3B340.45.4e-133734561197
                     HHTT-EE--HHH.HTT---..--SEEEEEETTS.-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
              B3  11 lksgrlvlpkkfaeehggkkeesktltledesg.rsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                      k ++l+lp +f+e++g++   + +++l  ++g  sW  +l   k++g++  + GWk+F+k ng+k g ++ ++++++ + ++v++++
  Csa16g046370.1 373 AKACMLYLPSHFMEANGIDR-IG-KIVLLGRKGsVSWCGYL--LKRDGAVNVGCGWKHFCKTNGVKIGGSFSLEFKHKVDNTPVLQFR 456
                     56799***********9884.55.67777766659******..*******************************99998888998877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.4E-1997195IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.85E-1997196IPR015300DNA-binding pseudobarrel domain
CDDcd100179.25E-17100185No hitNo description
PROSITE profilePS5086313.606100197IPR003340B3 DNA binding domain
SMARTSM010196.3E-22101197IPR003340B3 DNA binding domain
PfamPF023621.5E-18104193IPR003340B3 DNA binding domain
SMARTSM010197.6E-11211310IPR003340B3 DNA binding domain
PROSITE profilePS5086310.024211310IPR003340B3 DNA binding domain
PfamPF023626.4E-11211307IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.5E-10212305IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.08E-11214304IPR015300DNA-binding pseudobarrel domain
CDDcd100172.40E-8216308No hitNo description
Gene3DG3DSA:2.40.330.102.9E-12360458IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.095363458IPR003340B3 DNA binding domain
SMARTSM010197.9E-10364459IPR003340B3 DNA binding domain
SuperFamilySSF1019365.89E-13364457IPR015300DNA-binding pseudobarrel domain
PfamPF023623.2E-11374457IPR003340B3 DNA binding domain
CDDcd100175.05E-8376436No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 468 aa     Download sequence    Send to blast
LKVIQTTTNF ISIFFAPTRF LQQNLFFSSP QAKMYGVSAC DVRQPPSARN IDLNKTVNTS  60
KKHQRPTEEG GDVQENAVLV RAKRGRKKKS IPEAGLDNSS FFAFVTASNL EADTLYLPQD  120
FTSSCGLPKN FCKVVLTDGT GNSWELEMRY DKSCNRFYVN RGWRHFCDEL GKKVGSVFTF  180
ELMKKWGTPF LSFSPSKATP CYETSEDLDN FMTLNLSYDS LKNCRLYLPS AIMRTYGLDE  240
TRLVTLLAKD GTRTIANLVR ETSRRNFGRL SLGKAWREFA LANNLEVGEN FTLECIWENA  300
TPILRLTDTK PRRYIKRGPK PKYSGFCKKM SVSTAAKDAK EREKGKNIEE PINAASLIEK  360
HRLVILPLLR KDAKACMLYL PSHFMEANGI DRIGKIVLLG RKGSVSWCGY LLKRDGAVNV  420
GCGWKHFCKT NGVKIGGSFS LEFKHKVDNT PVLQFRPKLR RGININV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010472481.10.0PREDICTED: B3 domain-containing protein REM-like 2
TrEMBLD7LIB91e-129D7LIB9_ARALL; Putative uncharacterized protein
STRINGscaffold_400529.11e-129(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM78281641
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24696.11e-108B3 family protein